Lineage for d2c5eb_ (2c5e B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2449736Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2451247Protein automated matches [190085] (58 species)
    not a true protein
  7. 2451792Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [187183] (5 PDB entries)
  8. 2451795Domain d2c5eb_: 2c5e B: [129913]
    Other proteins in same PDB: d2c5ea1
    automated match to d2c59a1
    complexed with fmt, gdd, nad

Details for d2c5eb_

PDB Entry: 2c5e (more details), 1.7 Å

PDB Description: gdp-mannose-3', 5' -epimerase (arabidopsis thaliana), k217a, with gdp- alpha-d-mannose bound in the active site.
PDB Compounds: (B:) GDP-mannose-3', 5'-epimerase

SCOPe Domain Sequences for d2c5eb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c5eb_ c.2.1.2 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ytykelereqywpsenlkisitgaggfiashiarrlkheghyviasdwkknehmtedmfc
defhlvdlrvmenclkvtegvdhvfnlaadmggmgfiqsnhsvimynntmisfnmieaar
ingikrffyassaciypefkqlettnvslkesdawpaepqdaygleklateelckhynkd
fgiecrigrfhniygpfgtwkggreaapaafcrkaqtstdrfemwgdglqtrsftfidec
vegvlrltksdfrepvnigsdemvsmnemaemvlsfeekklpihhipgpegvrgrnsdnn
likeklgwapnmrlkeglrityfwikeqiekekakgsdvslygsskvvgtqapvqlgslr
a

SCOPe Domain Coordinates for d2c5eb_:

Click to download the PDB-style file with coordinates for d2c5eb_.
(The format of our PDB-style files is described here.)

Timeline for d2c5eb_: