Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) |
Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (70 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 |
Protein GDP-mannose-3', 5'-epimerase [141890] (1 species) |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [141891] (4 PDB entries) |
Domain d2c5eb1: 2c5e B:13-372 [129913] automatically matched to 2C5E A:13-375 complexed with fmt, gdd, nad; mutant |
PDB Entry: 2c5e (more details), 1.7 Å
SCOP Domain Sequences for d2c5eb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c5eb1 c.2.1.2 (B:13-372) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} tykelereqywpsenlkisitgaggfiashiarrlkheghyviasdwkknehmtedmfcd efhlvdlrvmenclkvtegvdhvfnlaadmggmgfiqsnhsvimynntmisfnmieaari ngikrffyassaciypefkqlettnvslkesdawpaepqdaygleklateelckhynkdf giecrigrfhniygpfgtwkggreaapaafcrkaqtstdrfemwgdglqtrsftfidecv egvlrltksdfrepvnigsdemvsmnemaemvlsfeekklpihhipgpegvrgrnsdnnl ikeklgwapnmrlkeglrityfwikeqiekekakgsdvslygsskvvgtqapvqlgslra
Timeline for d2c5eb1: