Lineage for d2c5ea1 (2c5e A:13-375)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 685975Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 685976Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 686289Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (70 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 686829Protein GDP-mannose-3', 5'-epimerase [141890] (1 species)
  7. 686830Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [141891] (4 PDB entries)
  8. 686835Domain d2c5ea1: 2c5e A:13-375 [129912]
    complexed with fmt, gdd, nad; mutant

Details for d2c5ea1

PDB Entry: 2c5e (more details), 1.7 Å

PDB Description: gdp-mannose-3', 5' -epimerase (arabidopsis thaliana), k217a, with gdp- alpha-d-mannose bound in the active site.
PDB Compounds: (A:) GDP-mannose-3', 5'-epimerase

SCOP Domain Sequences for d2c5ea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c5ea1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
tykelereqywpsenlkisitgaggfiashiarrlkheghyviasdwkknehmtedmfcd
efhlvdlrvmenclkvtegvdhvfnlaadmggmgfiqsnhsvimynntmisfnmieaari
ngikrffyassaciypefkqlettnvslkesdawpaepqdaygleklateelckhynkdf
giecrigrfhniygpfgtwkggreaapaafcrkaqtstdrfemwgdglqtrsftfidecv
egvlrltksdfrepvnigsdemvsmnemaemvlsfeekklpihhipgpegvrgrnsdnnl
ikeklgwapnmrlkeglrityfwikeqiekekakgsdvslygsskvvgtqapvqlgslra
adg

SCOP Domain Coordinates for d2c5ea1:

Click to download the PDB-style file with coordinates for d2c5ea1.
(The format of our PDB-style files is described here.)

Timeline for d2c5ea1: