Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) |
Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins) |
Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (4 species) phage-borne toxin; bacteriophages H30 and H19B |
Species Escherichia coli [TaxId:562] [50211] (17 PDB entries) |
Domain d2c5ci_: 2c5c I: [129910] automated match to d1bosa_ complexed with gla, s10, so4 |
PDB Entry: 2c5c (more details), 2.94 Å
SCOPe Domain Sequences for d2c5ci_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c5ci_ b.40.2.1 (I:) Verotoxin-1/shiga-toxin, B-pentamer {Escherichia coli [TaxId: 562]} tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng ggfsevifr
Timeline for d2c5ci_: