Lineage for d2c5ce1 (2c5c E:1-69)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 798661Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 798735Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 798736Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 799053Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (3 species)
    phage-borne toxin; bacteriophages H30 and H19B
  7. 799054Species Escherichia coli [TaxId:562] [50211] (13 PDB entries)
  8. 799129Domain d2c5ce1: 2c5c E:1-69 [129906]
    automatically matched to d1bosa_
    complexed with bgc, gal, gla, glc, s10, so4

Details for d2c5ce1

PDB Entry: 2c5c (more details), 2.94 Å

PDB Description: shiga-like toxin 1 b subunit complexed with a bivalent inhibitor
PDB Compounds: (E:) shiga-like toxin 1 b subunit

SCOP Domain Sequences for d2c5ce1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c5ce1 b.40.2.1 (E:1-69) Verotoxin-1/shiga-toxin, B-pentamer {Escherichia coli [TaxId: 562]}
tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
ggfsevifr

SCOP Domain Coordinates for d2c5ce1:

Click to download the PDB-style file with coordinates for d2c5ce1.
(The format of our PDB-style files is described here.)

Timeline for d2c5ce1: