Lineage for d2c5cd1 (2c5c D:1-69)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 667292Fold b.40: OB-fold [50198] (12 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 667366Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 667367Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 667664Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (3 species)
    phage-borne toxin; bacteriophages H30 and H19B
  7. 667665Species Escherichia coli [TaxId:562] [50211] (13 PDB entries)
  8. 667739Domain d2c5cd1: 2c5c D:1-69 [129905]
    automatically matched to d1bosa_
    complexed with bgc, gal, gla, glc, s10, so4

Details for d2c5cd1

PDB Entry: 2c5c (more details), 2.94 Å

PDB Description: shiga-like toxin 1 b subunit complexed with a bivalent inhibitor
PDB Compounds: (D:) shiga-like toxin 1 b subunit

SCOP Domain Sequences for d2c5cd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c5cd1 b.40.2.1 (D:1-69) Verotoxin-1/shiga-toxin, B-pentamer {Escherichia coli [TaxId: 562]}
tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
ggfsevifr

SCOP Domain Coordinates for d2c5cd1:

Click to download the PDB-style file with coordinates for d2c5cd1.
(The format of our PDB-style files is described here.)

Timeline for d2c5cd1: