![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.40: OB-fold [50198] (12 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) ![]() |
![]() | Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins) |
![]() | Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (3 species) phage-borne toxin; bacteriophages H30 and H19B |
![]() | Species Escherichia coli [TaxId:562] [50211] (13 PDB entries) |
![]() | Domain d2c5cc1: 2c5c C:1-69 [129904] automatically matched to d1bosa_ complexed with bgc, gal, gla, glc, s10, so4 |
PDB Entry: 2c5c (more details), 2.94 Å
SCOP Domain Sequences for d2c5cc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c5cc1 b.40.2.1 (C:1-69) Verotoxin-1/shiga-toxin, B-pentamer {Escherichia coli [TaxId: 562]} tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng ggfsevifr
Timeline for d2c5cc1: