Lineage for d2c5cc_ (2c5c C:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (4 species)
    phage-borne toxin; bacteriophages H30 and H19B
  7. Species Escherichia coli [TaxId:562] [50211] (17 PDB entries)
  8. Domain d2c5cc_: 2c5c C: [129904]
    automated match to d1bosa_
    complexed with gla, s10, so4

Details for d2c5cc_

PDB Entry: 2c5c (more details), 2.94 Å

PDB Description: shiga-like toxin 1 b subunit complexed with a bivalent inhibitor
PDB Compounds: (C:) shiga-like toxin 1 b subunit

SCOPe Domain Sequences for d2c5cc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c5cc_ b.40.2.1 (C:) Verotoxin-1/shiga-toxin, B-pentamer {Escherichia coli [TaxId: 562]}
tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
ggfsevifr

SCOPe Domain Coordinates for d2c5cc_ are not available.

Timeline for d2c5cc_:

Domains from other chains:
(mouse over for more information)
d2c5ca_, d2c5cb_, d2c5cd_, d2c5ce_, d2c5cf_, d2c5cg_, d2c5ch_, d2c5ci_, d2c5cj_