| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.132: Bacterial fluorinating enzyme, N-terminal domain [102521] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 6 strands; order: 213546, strand 5 is antiparallel to the rest; topological similarity to the MogA-like family fold |
Superfamily c.132.1: Bacterial fluorinating enzyme, N-terminal domain [102522] (2 families) ![]() |
| Family c.132.1.1: Bacterial fluorinating enzyme, N-terminal domain [102523] (2 proteins) |
| Protein 5'-fluoro-5'-deoxyadenosine synthase [102524] (1 species) |
| Species Streptomyces cattleya [TaxId:29303] [102525] (12 PDB entries) |
| Domain d2c5bc2: 2c5b C:8-192 [129901] Other proteins in same PDB: d2c5ba1, d2c5bb1, d2c5bc1 automated match to d1rqpa2 complexed with 5f1, met |
PDB Entry: 2c5b (more details), 2.4 Å
SCOPe Domain Sequences for d2c5bc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c5bc2 c.132.1.1 (C:8-192) 5'-fluoro-5'-deoxyadenosine synthase {Streptomyces cattleya [TaxId: 29303]}
rpiiafmsdlgttddsvaqckglmysicpdvtvvdvchsmtpwdveegaryivdlprffp
egtvfatttypatgtttrsvavrikqaakggargqwagsgagferaegsyiyiapnngll
ttvleehgyleayevtspkvipeqpeptfysremvaipsahlaagfplsevgrpledhei
vrfnr
Timeline for d2c5bc2:
View in 3DDomains from other chains: (mouse over for more information) d2c5ba1, d2c5ba2, d2c5bb1, d2c5bb2 |