Class b: All beta proteins [48724] (180 folds) |
Fold b.141: Bacterial fluorinating enzyme, C-terminal domain [101851] (1 superfamily) barrel, closed; n=7, S=10; greek-key topology; one overside connection |
Superfamily b.141.1: Bacterial fluorinating enzyme, C-terminal domain [101852] (2 families) |
Family b.141.1.1: Bacterial fluorinating enzyme, C-terminal domain [101853] (1 protein) |
Protein 5'-fluoro-5'-deoxyadenosine synthase [101854] (1 species) |
Species Streptomyces cattleya [TaxId:29303] [101855] (12 PDB entries) |
Domain d2c5bc1: 2c5b C:193-298 [129900] Other proteins in same PDB: d2c5ba2, d2c5bb2, d2c5bc2 automated match to d1rqpa1 complexed with 5f1, met |
PDB Entry: 2c5b (more details), 2.4 Å
SCOPe Domain Sequences for d2c5bc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c5bc1 b.141.1.1 (C:193-298) 5'-fluoro-5'-deoxyadenosine synthase {Streptomyces cattleya [TaxId: 29303]} paveqdgealvgvvsaidhpfgnvwtnihrtdlekagigygarlrltldgvlpfeapltp tfadageigniaiylnsrgylsiarnaaslaypyhlkegmsarvea
Timeline for d2c5bc1:
View in 3D Domains from other chains: (mouse over for more information) d2c5ba1, d2c5ba2, d2c5bb1, d2c5bb2 |