SCOP 1.73: Domain d2c59b1: 2c59 B:13-371

Lineage for d2c59b1 (2c59 B:13-371)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (70 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

6. Protein GDP-mannose-3', 5'-epimerase [141890] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [141891] (4 PDB entries)

8. Domain d2c59b1: 2c59 B:13-371 [129893]
   automatically matched to 2C59 A:13-375
   complexed with btb, fmt, gdc, gdd, nad

Details for d2c59b1

PDB Entry: 2c59, 2 Å

PDB Description: gdp-mannose-3', 5' -epimerase (arabidopsis thaliana), with gdp-alpha- d-mannose and gdp-beta-l-galactose bound in the active site.

PDB Compounds: (B:) GDP-mannose-3', 5'-epimerase

SCOP Domain Sequences for d2c59b1:

Sequence; same for both SEQRES and ATOM records:

>d2c59b1 c.2.1.2 (B:13-371) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
tykelereqywpsenlkisitgaggfiashiarrlkheghyviasdwkknehmtedmfcd
efhlvdlrvmenclkvtegvdhvfnlaadmggmgfiqsnhsvimynntmisfnmieaari
ngikrffyassaciypefkqlettnvslkesdawpaepqdaygleklateelckhynkdf
giecrigrfhniygpfgtwkggrekapaafcrkaqtstdrfemwgdglqtrsftfidecv
egvlrltksdfrepvnigsdemvsmnemaemvlsfeekklpihhipgpegvrgrnsdnnl
ikeklgwapnmrlkeglrityfwikeqiekekakgsdvslygsskvvgtqapvqlgslr

Timeline for d2c59b1:

• d2c59b1 is new in SCOP 1.73
  
• d2c59b1 appears in SCOP 1.75
  
• d2c59b1 appears in the current release, SCOPe 2.08, called d2c59b_