Lineage for d2c57d2 (2c57 D:-9-158)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families) (S)
  5. Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (2 proteins)
    automatically mapped to Pfam PF01220
  6. Protein automated matches [190071] (6 species)
    not a true protein
  7. Species Helicobacter pylori [TaxId:210] [187015] (7 PDB entries)
  8. Domain d2c57d2: 2c57 D:-9-158 [129882]
    Other proteins in same PDB: d2c57a3, d2c57d3, d2c57g3, d2c57j3
    automated match to d4b6ra_
    complexed with fa1

Details for d2c57d2

PDB Entry: 2c57 (more details), 3.1 Å

PDB Description: h.pylori type ii dehydroquinase in complex with fa1
PDB Compounds: (D:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d2c57d2:

Sequence, based on SEQRES records: (download)

>d2c57d2 c.23.13.1 (D:-9-158) automated matches {Helicobacter pylori [TaxId: 210]}
ssshmkilviqgpnlnmlghrdprlygmvtldqiheimqtfvkqgnldveleffqtnfeg
eiidkiqesvgsdyegiiinpgafshtsiaiadaimlagkpvievhltniqareefrkns
ytgaacggvimgfgplgynmalmamvnilaemkafqeaqknn

Sequence, based on observed residues (ATOM records): (download)

>d2c57d2 c.23.13.1 (D:-9-158) automated matches {Helicobacter pylori [TaxId: 210]}
ssshmkilviqgpnlnmlggmvtldqiheimqtfvkqgnldveleffqtnfegeiidkiq
esvgsdyegiiinpgafshtsiaiadaimlagkpvievhltniqareefrknsytgaacg
gvimgfgplgynmalmamvnilaemkafqeaqknn

SCOPe Domain Coordinates for d2c57d2 are not available.

Timeline for d2c57d2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2c57d3
View in 3D
Domains from other chains:
(mouse over for more information)
d2c57a2, d2c57a3, d2c57b_, d2c57c_, d2c57e_, d2c57f_, d2c57g2, d2c57g3, d2c57h_, d2c57i_, d2c57j2, d2c57j3, d2c57k_, d2c57l_