SCOPe 2.01: Domain d2c54b_: 2c54 B:

Lineage for d2c54b_ (2c54 B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

6. Protein automated matches [190085] (29 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [187183] (5 PDB entries)

8. Domain d2c54b_: 2c54 B: [129878]
   Other proteins in same PDB: d2c54a1
   automated match to d2c59a1
   complexed with epe, fmt, gkd, gke, nad

Details for d2c54b_

PDB Entry: 2c54, 1.5 Å

PDB Description: gdp-mannose-3', 5' -epimerase (arabidopsis thaliana),k178r, with gdp- beta-l-gulose and gdp-4-keto-beta-l-gulose bound in active site.

PDB Compounds: (B:) GDP-mannose-3', 5'-epimerase

SCOPe Domain Sequences for d2c54b_:

Sequence; same for both SEQRES and ATOM records:

>d2c54b_ c.2.1.2 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ytykelereqywpsenlkisitgaggfiashiarrlkheghyviasdwkknehmtedmfc
defhlvdlrvmenclkvtegvdhvfnlaadmggmgfiqsnhsvimynntmisfnmieaar
ingikrffyassaciypefkqlettnvslkesdawpaepqdayglerlateelckhynkd
fgiecrigrfhniygpfgtwkggrekapaafcrkaqtstdrfemwgdglqtrsftfidec
vegvlrltksdfrepvnigsdemvsmnemaemvlsfeekklpihhipgpegvrgrnsdnn
likeklgwapnmrlkeglrityfwikeqiekekakgsdvslygsskvvgtqapvqlgslr

Timeline for d2c54b_:

• d2c54b_ first appeared in SCOP 1.73, called d2c54b1
  
• d2c54b_ was called d2c54b1 in SCOP 1.75
  
• d2c54b_ appears in SCOPe 2.02
  
• d2c54b_ appears in the current release, SCOPe 2.08