Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 |
Protein automated matches [190085] (29 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [187183] (5 PDB entries) |
Domain d2c54b_: 2c54 B: [129878] Other proteins in same PDB: d2c54a1 automated match to d2c59a1 complexed with epe, fmt, gkd, gke, nad |
PDB Entry: 2c54 (more details), 1.5 Å
SCOPe Domain Sequences for d2c54b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c54b_ c.2.1.2 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} ytykelereqywpsenlkisitgaggfiashiarrlkheghyviasdwkknehmtedmfc defhlvdlrvmenclkvtegvdhvfnlaadmggmgfiqsnhsvimynntmisfnmieaar ingikrffyassaciypefkqlettnvslkesdawpaepqdayglerlateelckhynkd fgiecrigrfhniygpfgtwkggrekapaafcrkaqtstdrfemwgdglqtrsftfidec vegvlrltksdfrepvnigsdemvsmnemaemvlsfeekklpihhipgpegvrgrnsdnn likeklgwapnmrlkeglrityfwikeqiekekakgsdvslygsskvvgtqapvqlgslr
Timeline for d2c54b_: