SCOP 1.75: Domain d2c50a1: 2c50 A:1-129

Lineage for d2c50a1 (2c50 A:1-129)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
   6-standed beta-sheet followed with 2 helices; meander

4. Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family)

5. Family d.85.1.1: RNA bacteriophage capsid protein [55406] (5 proteins)

6. Protein MS2 virus coat protein [55407] (1 species)

7. Species Bacteriophage MS2 [TaxId:12022] [55408] (27 PDB entries)
   Uniprot P03612

8. Domain d2c50a1: 2c50 A:1-129 [129870]
   automatically matched to d1dzsa_
   mutant

Details for d2c50a1

PDB Entry: 2c50, 2.65 Å

PDB Description: ms2-rna hairpin (a -5) complex

PDB Compounds: (A:) coat protein

SCOP Domain Sequences for d2c50a1:

Sequence; same for both SEQRES and ATOM records:

>d2c50a1 d.85.1.1 (A:1-129) MS2 virus coat protein {Bacteriophage MS2 [TaxId: 12022]}
asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
aiaansgiy

Timeline for d2c50a1:

• d2c50a1 first appeared in SCOP 1.73
  
• d2c50a1 is called d2c50a_ in SCOPe 2.01
  
• d2c50a1 appears in the current release, SCOPe 2.08, called d2c50a_