| Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
| Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily) 6-standed beta-sheet followed with 2 helices; meander |
Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) ![]() |
| Family d.85.1.1: RNA bacteriophage capsid protein [55406] (5 proteins) |
| Protein MS2 virus coat protein [55407] (1 species) |
| Species Bacteriophage MS2 [TaxId:12022] [55408] (26 PDB entries) |
| Domain d2c50a1: 2c50 A:1-129 [129870] automatically matched to d1dzsa_ mutant |
PDB Entry: 2c50 (more details), 2.65 Å
SCOP Domain Sequences for d2c50a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c50a1 d.85.1.1 (A:1-129) MS2 virus coat protein {Bacteriophage MS2 [TaxId: 12022]}
asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
aiaansgiy
Timeline for d2c50a1: