SCOPe 2.05: Domain d2c4zb_: 2c4z B:

Lineage for d2c4zb_ (2c4z B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
   6-standed beta-sheet followed with 2 helices; meander

4. Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family)

5. Family d.85.1.1: RNA bacteriophage capsid protein [55406] (6 proteins)

6. Protein MS2 virus coat protein [55407] (1 species)

7. Species Bacteriophage MS2 [TaxId:12022] [55408] (28 PDB entries)
   Uniprot P03612

8. Domain d2c4zb_: 2c4z B: [129868]
   automated match to d1dzsa_
   protein/RNA complex

Details for d2c4zb_

PDB Entry: 2c4z, 2.6 Å

PDB Description: ms2-rna hairpin (2su -5-6) complex

PDB Compounds: (B:) coat protein

SCOPe Domain Sequences for d2c4zb_:

Sequence; same for both SEQRES and ATOM records:

>d2c4zb_ d.85.1.1 (B:) MS2 virus coat protein {Bacteriophage MS2 [TaxId: 12022]}
asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
aiaansgiy

Timeline for d2c4zb_:

• d2c4zb_ first appeared in SCOP 1.73, called d2c4zb1
  
• d2c4zb_ appears in SCOPe 2.04
  
• d2c4zb_ appears in SCOPe 2.06
  
• d2c4zb_ appears in the current release, SCOPe 2.08