Lineage for d2c4va1 (2c4v A:1-158)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 691580Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 692549Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (1 family) (S)
  5. 692550Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (1 protein)
  6. 692551Protein Type II 3-dehydroquinate dehydratase [52306] (5 species)
  7. 692590Species Helicobacter pylori [TaxId:210] [89598] (3 PDB entries)
  8. 692591Domain d2c4va1: 2c4v A:1-158 [129863]
    automatically matched to d1j2ya_
    complexed with cit

Details for d2c4va1

PDB Entry: 2c4v (more details), 2.5 Å

PDB Description: h. pylori type ii dhqase in complex with citrate
PDB Compounds: (A:) 3-dehydroquinate dehydratase

SCOP Domain Sequences for d2c4va1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c4va1 c.23.13.1 (A:1-158) Type II 3-dehydroquinate dehydratase {Helicobacter pylori [TaxId: 210]}
mkilviqgpnlnmlghrdprlygmvtldqiheimqtfvkqgnldveleffqtnfegeiid
kiqesvgsdyegiiinpgafshtsiaiadaimlagkpvievhltniqareefrknsytga
acggvimgfgplgynmalmamvnilaemkafqeaqknn

SCOP Domain Coordinates for d2c4va1:

Click to download the PDB-style file with coordinates for d2c4va1.
(The format of our PDB-style files is described here.)

Timeline for d2c4va1: