![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.141: Bacterial fluorinating enzyme, C-terminal domain [101851] (1 superfamily) barrel, closed; n=7, S=10; greek-key topology; one overside connection |
![]() | Superfamily b.141.1: Bacterial fluorinating enzyme, C-terminal domain [101852] (2 families) ![]() |
![]() | Family b.141.1.1: Bacterial fluorinating enzyme, C-terminal domain [101853] (1 protein) |
![]() | Protein 5'-fluoro-5'-deoxyadenosine synthase [101854] (1 species) |
![]() | Species Streptomyces cattleya [TaxId:29303] [101855] (12 PDB entries) |
![]() | Domain d2c4uf1: 2c4u F:193-298 [129861] Other proteins in same PDB: d2c4ua2, d2c4ub2, d2c4uc2, d2c4ud2, d2c4ue2, d2c4uf2 automated match to d1rqpa1 complexed with gol |
PDB Entry: 2c4u (more details), 2.5 Å
SCOPe Domain Sequences for d2c4uf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c4uf1 b.141.1.1 (F:193-298) 5'-fluoro-5'-deoxyadenosine synthase {Streptomyces cattleya [TaxId: 29303]} paveqdgealvgvvsaidhpfgnvwtnihrtdlekagigygarlrltldgvlpfeapltp tfadageigniaiylnsrgylsiarnaaslaypyhlkegmsarvea
Timeline for d2c4uf1: