SCOP 1.73: Domain d2c4ue1: 2c4u E:193-298

Lineage for d2c4ue1 (2c4u E:193-298)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.141: Bacterial fluorinating enzyme, C-terminal domain [101851] (1 superfamily)
   barrel, closed; n=7, S=10; greek-key topology; one overside connection

4. Superfamily b.141.1: Bacterial fluorinating enzyme, C-terminal domain [101852] (1 family)

5. Family b.141.1.1: Bacterial fluorinating enzyme, C-terminal domain [101853] (1 protein)

6. Protein 5'-fluoro-5'-deoxyadenosine synthase [101854] (1 species)

7. Species Streptomyces cattleya [TaxId:29303] [101855] (9 PDB entries)

8. Domain d2c4ue1: 2c4u E:193-298 [129859]
   Other proteins in same PDB: d2c4ua2, d2c4ub2, d2c4uc2, d2c4ud2, d2c4ue2, d2c4uf2
   automatically matched to d1rqpa1
   complexed with gol

Details for d2c4ue1

PDB Entry: 2c4u, 2.5 Å

PDB Description: crystal structure of the apo form of the 5'-fluoro-5'-deoxyadenosine synthase enzyme from streptomyces cattleya

PDB Compounds: (E:) 5'-fluoro-5'-deoxyadenosine synthase

SCOP Domain Sequences for d2c4ue1:

Sequence; same for both SEQRES and ATOM records:

>d2c4ue1 b.141.1.1 (E:193-298) 5'-fluoro-5'-deoxyadenosine synthase {Streptomyces cattleya [TaxId: 29303]}
paveqdgealvgvvsaidhpfgnvwtnihrtdlekagigygarlrltldgvlpfeapltp
tfadageigniaiylnsrgylsiarnaaslaypyhlkegmsarvea

Timeline for d2c4ue1:

• d2c4ue1 is new in SCOP 1.73
  
• d2c4ue1 appears in SCOP 1.75
  
• d2c4ue1 appears in the current release, SCOPe 2.08