![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.132: Bacterial fluorinating enzyme, N-terminal domain [102521] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 6 strands; order: 213546, strand 5 is antiparallel to the rest; topological similarity to the MogA-like family fold |
![]() | Superfamily c.132.1: Bacterial fluorinating enzyme, N-terminal domain [102522] (2 families) ![]() |
![]() | Family c.132.1.1: Bacterial fluorinating enzyme, N-terminal domain [102523] (2 proteins) |
![]() | Protein 5'-fluoro-5'-deoxyadenosine synthase [102524] (1 species) |
![]() | Species Streptomyces cattleya [TaxId:29303] [102525] (12 PDB entries) |
![]() | Domain d2c4uc2: 2c4u C:8-192 [129856] Other proteins in same PDB: d2c4ua1, d2c4ub1, d2c4uc1, d2c4ud1, d2c4ue1, d2c4uf1 automated match to d1rqpa2 complexed with gol |
PDB Entry: 2c4u (more details), 2.5 Å
SCOPe Domain Sequences for d2c4uc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c4uc2 c.132.1.1 (C:8-192) 5'-fluoro-5'-deoxyadenosine synthase {Streptomyces cattleya [TaxId: 29303]} rpiiafmsdlgttddsvaqckglmysicpdvtvvdvchsmtpwdveegaryivdlprffp egtvfatttypatgtttrsvavrikqaakggargqwagsgagferaegsyiyiapnngll ttvleehgyleayevtspkvipeqpeptfysremvaipsahlaagfplsevgrpledhei vrfnr
Timeline for d2c4uc2: