Class b: All beta proteins [48724] (174 folds) |
Fold b.141: Bacterial fluorinating enzyme, C-terminal domain [101851] (1 superfamily) barrel, closed; n=7, S=10; greek-key topology; one overside connection |
Superfamily b.141.1: Bacterial fluorinating enzyme, C-terminal domain [101852] (1 family) |
Family b.141.1.1: Bacterial fluorinating enzyme, C-terminal domain [101853] (1 protein) |
Protein 5'-fluoro-5'-deoxyadenosine synthase [101854] (1 species) |
Species Streptomyces cattleya [TaxId:29303] [101855] (14 PDB entries) |
Domain d2c4uc1: 2c4u C:193-298 [129855] Other proteins in same PDB: d2c4ua2, d2c4ub2, d2c4uc2, d2c4ud2, d2c4ue2, d2c4uf2 automatically matched to d1rqpa1 complexed with gol |
PDB Entry: 2c4u (more details), 2.5 Å
SCOP Domain Sequences for d2c4uc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c4uc1 b.141.1.1 (C:193-298) 5'-fluoro-5'-deoxyadenosine synthase {Streptomyces cattleya [TaxId: 29303]} paveqdgealvgvvsaidhpfgnvwtnihrtdlekagigygarlrltldgvlpfeapltp tfadageigniaiylnsrgylsiarnaaslaypyhlkegmsarvea
Timeline for d2c4uc1: