Lineage for d2c4ub2 (2c4u B:8-192)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2923098Fold c.132: Bacterial fluorinating enzyme, N-terminal domain [102521] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands; order: 213546, strand 5 is antiparallel to the rest; topological similarity to the MogA-like family fold
  4. 2923099Superfamily c.132.1: Bacterial fluorinating enzyme, N-terminal domain [102522] (2 families) (S)
  5. 2923100Family c.132.1.1: Bacterial fluorinating enzyme, N-terminal domain [102523] (2 proteins)
  6. 2923101Protein 5'-fluoro-5'-deoxyadenosine synthase [102524] (1 species)
  7. 2923102Species Streptomyces cattleya [TaxId:29303] [102525] (12 PDB entries)
  8. 2923131Domain d2c4ub2: 2c4u B:8-192 [129854]
    Other proteins in same PDB: d2c4ua1, d2c4ub1, d2c4uc1, d2c4ud1, d2c4ue1, d2c4uf1
    automated match to d1rqpa2
    complexed with gol

Details for d2c4ub2

PDB Entry: 2c4u (more details), 2.5 Å

PDB Description: crystal structure of the apo form of the 5'-fluoro-5'-deoxyadenosine synthase enzyme from streptomyces cattleya
PDB Compounds: (B:) 5'-fluoro-5'-deoxyadenosine synthase

SCOPe Domain Sequences for d2c4ub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c4ub2 c.132.1.1 (B:8-192) 5'-fluoro-5'-deoxyadenosine synthase {Streptomyces cattleya [TaxId: 29303]}
rpiiafmsdlgttddsvaqckglmysicpdvtvvdvchsmtpwdveegaryivdlprffp
egtvfatttypatgtttrsvavrikqaakggargqwagsgagferaegsyiyiapnngll
ttvleehgyleayevtspkvipeqpeptfysremvaipsahlaagfplsevgrpledhei
vrfnr

SCOPe Domain Coordinates for d2c4ub2:

Click to download the PDB-style file with coordinates for d2c4ub2.
(The format of our PDB-style files is described here.)

Timeline for d2c4ub2: