Lineage for d2c4ua2 (2c4u A:8-192)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1886087Fold c.132: Bacterial fluorinating enzyme, N-terminal domain [102521] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands; order: 213546, strand 5 is antiparallel to the rest; topological similarity to the MogA-like family fold
  4. 1886088Superfamily c.132.1: Bacterial fluorinating enzyme, N-terminal domain [102522] (2 families) (S)
  5. 1886089Family c.132.1.1: Bacterial fluorinating enzyme, N-terminal domain [102523] (2 proteins)
  6. 1886090Protein 5'-fluoro-5'-deoxyadenosine synthase [102524] (1 species)
  7. 1886091Species Streptomyces cattleya [TaxId:29303] [102525] (11 PDB entries)
  8. 1886116Domain d2c4ua2: 2c4u A:8-192 [129852]
    Other proteins in same PDB: d2c4ua1, d2c4ub1, d2c4uc1, d2c4ud1, d2c4ue1, d2c4uf1
    automated match to d1rqpa2
    complexed with gol

Details for d2c4ua2

PDB Entry: 2c4u (more details), 2.5 Å

PDB Description: crystal structure of the apo form of the 5'-fluoro-5'-deoxyadenosine synthase enzyme from streptomyces cattleya
PDB Compounds: (A:) 5'-fluoro-5'-deoxyadenosine synthase

SCOPe Domain Sequences for d2c4ua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c4ua2 c.132.1.1 (A:8-192) 5'-fluoro-5'-deoxyadenosine synthase {Streptomyces cattleya [TaxId: 29303]}
rpiiafmsdlgttddsvaqckglmysicpdvtvvdvchsmtpwdveegaryivdlprffp
egtvfatttypatgtttrsvavrikqaakggargqwagsgagferaegsyiyiapnngll
ttvleehgyleayevtspkvipeqpeptfysremvaipsahlaagfplsevgrpledhei
vrfnr

SCOPe Domain Coordinates for d2c4ua2:

Click to download the PDB-style file with coordinates for d2c4ua2.
(The format of our PDB-style files is described here.)

Timeline for d2c4ua2: