SCOPe 2.06: Domain d2c4tc1: 2c4t C:193-298

Lineage for d2c4tc1 (2c4t C:193-298)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.141: Bacterial fluorinating enzyme, C-terminal domain [101851] (1 superfamily)
   barrel, closed; n=7, S=10; greek-key topology; one overside connection

4. Superfamily b.141.1: Bacterial fluorinating enzyme, C-terminal domain [101852] (2 families)

5. Family b.141.1.1: Bacterial fluorinating enzyme, C-terminal domain [101853] (1 protein)

6. Protein 5'-fluoro-5'-deoxyadenosine synthase [101854] (1 species)

7. Species Streptomyces cattleya [TaxId:29303] [101855] (12 PDB entries)

8. Domain d2c4tc1: 2c4t C:193-298 [129849]
   Other proteins in same PDB: d2c4ta2, d2c4tb2, d2c4tc2
   automated match to d1rqpa1
   complexed with cl, sa8

Details for d2c4tc1

PDB Entry: 2c4t, 2.3 Å

PDB Description: x-ray crystal structure of 5'-fluorodeoxyadenosine synthase from streptomyces cattleya complexed with an inhibitor, an analogue of s- adenosyl methionine

PDB Compounds: (C:) 5'-fluoro-5'-deoxyadenosine synthase

SCOPe Domain Sequences for d2c4tc1:

Sequence; same for both SEQRES and ATOM records:

>d2c4tc1 b.141.1.1 (C:193-298) 5'-fluoro-5'-deoxyadenosine synthase {Streptomyces cattleya [TaxId: 29303]}
paveqdgealvgvvsaidhpfgnvwtnihrtdlekagigygarlrltldgvlpfeapltp
tfadageigniaiylnsrgylsiarnaaslaypyhlkegmsarvea

Timeline for d2c4tc1:

• d2c4tc1 first appeared in SCOP 1.73
  
• d2c4tc1 appears in SCOPe 2.05
  
• d2c4tc1 appears in SCOPe 2.07
  
• d2c4tc1 appears in the current release, SCOPe 2.08