Lineage for d2c4tb1 (2c4t B:193-298)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2824820Fold b.141: Bacterial fluorinating enzyme, C-terminal domain [101851] (1 superfamily)
    barrel, closed; n=7, S=10; greek-key topology; one overside connection
  4. 2824821Superfamily b.141.1: Bacterial fluorinating enzyme, C-terminal domain [101852] (2 families) (S)
  5. 2824822Family b.141.1.1: Bacterial fluorinating enzyme, C-terminal domain [101853] (1 protein)
  6. 2824823Protein 5'-fluoro-5'-deoxyadenosine synthase [101854] (1 species)
  7. 2824824Species Streptomyces cattleya [TaxId:29303] [101855] (12 PDB entries)
  8. 2824850Domain d2c4tb1: 2c4t B:193-298 [129847]
    Other proteins in same PDB: d2c4ta2, d2c4tb2, d2c4tc2
    automated match to d1rqpa1
    complexed with cl, sa8

Details for d2c4tb1

PDB Entry: 2c4t (more details), 2.3 Å

PDB Description: x-ray crystal structure of 5'-fluorodeoxyadenosine synthase from streptomyces cattleya complexed with an inhibitor, an analogue of s- adenosyl methionine
PDB Compounds: (B:) 5'-fluoro-5'-deoxyadenosine synthase

SCOPe Domain Sequences for d2c4tb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c4tb1 b.141.1.1 (B:193-298) 5'-fluoro-5'-deoxyadenosine synthase {Streptomyces cattleya [TaxId: 29303]}
paveqdgealvgvvsaidhpfgnvwtnihrtdlekagigygarlrltldgvlpfeapltp
tfadageigniaiylnsrgylsiarnaaslaypyhlkegmsarvea

SCOPe Domain Coordinates for d2c4tb1:

Click to download the PDB-style file with coordinates for d2c4tb1.
(The format of our PDB-style files is described here.)

Timeline for d2c4tb1: