Lineage for d2c4qb_ (2c4q B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2962441Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
    6-standed beta-sheet followed with 2 helices; meander
  4. 2962442Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) (S)
  5. 2962443Family d.85.1.1: RNA bacteriophage capsid protein [55406] (6 proteins)
  6. 2962492Protein MS2 virus coat protein [55407] (1 species)
  7. 2962493Species Bacteriophage MS2 [TaxId:12022] [55408] (36 PDB entries)
    Uniprot P03612
  8. 2962573Domain d2c4qb_: 2c4q B: [129843]
    automated match to d1dzsa_
    protein/RNA complex

Details for d2c4qb_

PDB Entry: 2c4q (more details), 2.38 Å

PDB Description: ms2-rna hairpin (2one -5) complex
PDB Compounds: (B:) coat protein

SCOPe Domain Sequences for d2c4qb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c4qb_ d.85.1.1 (B:) MS2 virus coat protein {Bacteriophage MS2 [TaxId: 12022]}
asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
aiaansgiy

SCOPe Domain Coordinates for d2c4qb_:

Click to download the PDB-style file with coordinates for d2c4qb_.
(The format of our PDB-style files is described here.)

Timeline for d2c4qb_: