Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (23 families) usually contains an insertion (sub)domain after strand 1 |
Family c.108.1.14: NagD-like [102317] (6 proteins) duplication: consists of two segment-swapped domains of this fold; this results in the insertion of a circularly permuted domain after strand 3, analogously to the Cof family |
Protein NagD [142169] (1 species) |
Species Escherichia coli [TaxId:562] [142170] (1 PDB entry) |
Domain d2c4na1: 2c4n A:1-250 [129837] complexed with mg, po4 |
PDB Entry: 2c4n (more details), 1.8 Å
SCOP Domain Sequences for d2c4na1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]} mtiknvicdidgvlmhdnvavpgaaeflhgimdkglplvlltnypsqtgqdlanrfatag vdvpdsvfytsamatadflrrqegkkayvvgegalihelykagftitdvnpdfvivgetr synwdmmhkaayfvangarfiatnpdthgrgfypacgalcagiekisgrkpfyvgkpspw iiraalnkmqahseetvivgdnlrtdilagfqagletilvlsgvsslddidsmpfrpswi ypsvaeidvi
Timeline for d2c4na1: