SCOPe 2.08: Domain d2c4na1: 2c4n A:1-250

Lineage for d2c4na1 (2c4n A:1-250)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.14: NagD-like [102317] (7 proteins)
   duplication: consists of two segment-swapped domains of this fold; this results in the insertion of a circularly permuted domain after strand 3, analogously to the Cof family

6. Protein NagD [142169] (1 species)

7. Species Escherichia coli [TaxId:562] [142170] (1 PDB entry)
   Uniprot P0AF24 1-250

8. Domain d2c4na1: 2c4n A:1-250 [129837]
   complexed with mg, po4

Details for d2c4na1

PDB Entry: 2c4n, 1.8 Å

PDB Description: nagd from e.coli k-12 strain

PDB Compounds: (A:) protein nagd

SCOPe Domain Sequences for d2c4na1:

Sequence; same for both SEQRES and ATOM records:

>d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]}
mtiknvicdidgvlmhdnvavpgaaeflhgimdkglplvlltnypsqtgqdlanrfatag
vdvpdsvfytsamatadflrrqegkkayvvgegalihelykagftitdvnpdfvivgetr
synwdmmhkaayfvangarfiatnpdthgrgfypacgalcagiekisgrkpfyvgkpspw
iiraalnkmqahseetvivgdnlrtdilagfqagletilvlsgvsslddidsmpfrpswi
ypsvaeidvi

Timeline for d2c4na1:

• d2c4na1 first appeared in SCOP 1.73
  
• d2c4na1 appears in SCOPe 2.07