Lineage for d2c4na1 (2c4n A:1-250)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2490779Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2490780Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2491338Family c.108.1.14: NagD-like [102317] (7 proteins)
    duplication: consists of two segment-swapped domains of this fold; this results in the insertion of a circularly permuted domain after strand 3, analogously to the Cof family
  6. 2491346Protein NagD [142169] (1 species)
  7. 2491347Species Escherichia coli [TaxId:562] [142170] (1 PDB entry)
    Uniprot P0AF24 1-250
  8. 2491348Domain d2c4na1: 2c4n A:1-250 [129837]
    complexed with mg, po4

Details for d2c4na1

PDB Entry: 2c4n (more details), 1.8 Å

PDB Description: nagd from e.coli k-12 strain
PDB Compounds: (A:) protein nagd

SCOPe Domain Sequences for d2c4na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]}
mtiknvicdidgvlmhdnvavpgaaeflhgimdkglplvlltnypsqtgqdlanrfatag
vdvpdsvfytsamatadflrrqegkkayvvgegalihelykagftitdvnpdfvivgetr
synwdmmhkaayfvangarfiatnpdthgrgfypacgalcagiekisgrkpfyvgkpspw
iiraalnkmqahseetvivgdnlrtdilagfqagletilvlsgvsslddidsmpfrpswi
ypsvaeidvi

SCOPe Domain Coordinates for d2c4na1:

Click to download the PDB-style file with coordinates for d2c4na1.
(The format of our PDB-style files is described here.)

Timeline for d2c4na1: