Lineage for d2c4la1 (2c4l A:82-468)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 674916Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 674917Superfamily b.68.1: Sialidases [50939] (2 families) (S)
  5. 674918Family b.68.1.1: Sialidases (neuraminidases) [50940] (9 proteins)
  6. 674931Protein Influenza neuraminidase [50943] (2 species)
  7. 674932Species Influenza A virus, different strains [TaxId:11320] [50944] (52 PDB entries)
  8. 674952Domain d2c4la1: 2c4l A:82-468 [129836]
    automatically matched to d1ncan_
    complexed with bma, ca, man, nag, sia

Details for d2c4la1

PDB Entry: 2c4l (more details), 2.15 Å

PDB Description: structure of neuraminidase subtype n9 complexed with 30 mm sialic acid (nana, neu5ac), crystal soaked for 24 hours at 291 k and finally backsoaked for 30 min in a cryoprotectant solution which did not contain neu5ac
PDB Compounds: (A:) neuraminidase subtype n9

SCOP Domain Sequences for d2c4la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c4la1 b.68.1.1 (A:82-468) Influenza neuraminidase {Influenza A virus, different strains [TaxId: 11320]}
rdfnnltkglctinswhiygkdnavrigedsdvlvtrepyvscdpdecrfyalsqgttir
gkhsngtihdrsqyraliswplsspptvynsrvecigwsstschdgktrmsicisgpnnn
asaviwynrrpvteintwarnilrtqesecvchngvcpvvftdgsatgpaetriyyfkeg
kilkweplagtakhieecscygeraeitctcrdnwqgsnrpviridpvamthtsqyicsp
vltdnprpndptvgkcndpypgnnnngvkgfsyldgvntwlgrtisiasrsgyemlkvpn
altddkskptqgqtivlntdwsgysgsfmdywaegecyracfyvelirgrpkedkvwwts
nsivsmcssteflgqwdwpdgakieyfl

SCOP Domain Coordinates for d2c4la1:

Click to download the PDB-style file with coordinates for d2c4la1.
(The format of our PDB-style files is described here.)

Timeline for d2c4la1: