Lineage for d2c4la_ (2c4l A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins)
  6. Protein Influenza neuraminidase [50943] (9 species)
  7. Species Influenza A virus, different strains [TaxId:11320] [50944] (89 PDB entries)
    Uniprot P03472 84-470
  8. Domain d2c4la_: 2c4l A: [129836]
    automated match to d1a14n_
    complexed with bma, ca, nag, sia

Details for d2c4la_

PDB Entry: 2c4l (more details), 2.15 Å

PDB Description: structure of neuraminidase subtype n9 complexed with 30 mm sialic acid (nana, neu5ac), crystal soaked for 24 hours at 291 k and finally backsoaked for 30 min in a cryoprotectant solution which did not contain neu5ac
PDB Compounds: (A:) neuraminidase subtype n9

SCOPe Domain Sequences for d2c4la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c4la_ b.68.1.1 (A:) Influenza neuraminidase {Influenza A virus, different strains [TaxId: 11320]}
rdfnnltkglctinswhiygkdnavrigedsdvlvtrepyvscdpdecrfyalsqgttir
gkhsngtihdrsqyraliswplsspptvynsrvecigwsstschdgktrmsicisgpnnn
asaviwynrrpvteintwarnilrtqesecvchngvcpvvftdgsatgpaetriyyfkeg
kilkweplagtakhieecscygeraeitctcrdnwqgsnrpviridpvamthtsqyicsp
vltdnprpndptvgkcndpypgnnnngvkgfsyldgvntwlgrtisiasrsgyemlkvpn
altddkskptqgqtivlntdwsgysgsfmdywaegecyracfyvelirgrpkedkvwwts
nsivsmcssteflgqwdwpdgakieyfl

SCOPe Domain Coordinates for d2c4la_ are not available.

Timeline for d2c4la_: