SCOP 1.73: Domain d2c4kd2: 2c4k D:167-350

Lineage for d2c4kd2 (2c4k D:167-350)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (2 families)

5. Family c.61.1.2: Phosphoribosylpyrophosphate synthetase-like [53296] (2 proteins)
   duplication: consists of two domains of this fold

6. Protein PRPP synthetase-associated protein 1 [142563] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [142564] (1 PDB entry)

8. Domain d2c4kd2: 2c4k D:167-350 [129831]
   automatically matched to 2C4K A:167-350
   complexed with so4, tam

Details for d2c4kd2

PDB Entry: 2c4k, 2.65 Å

PDB Description: crystal structure of human phosphoribosylpyrophosphate synthetase- associated protein 39 (pap39)

PDB Compounds: (D:) phosphoribosyl pyrophosphate synthetase-associated protein 1

SCOP Domain Sequences for d2c4kd2:

Sequence, based on SEQRES records:

>d2c4kd2 c.61.1.2 (D:167-350) PRPP synthetase-associated protein 1 {Human (Homo sapiens) [TaxId: 9606]}
nyrnavivakspdaakraqsyaerlrlglavihgeaqcteldmddgrhsppmvknatvhp
glelplmmakekppitvvgdvggriaiivddiiddvesfvaaaeilkergaykiyvmath
gilsaeaprlieessvdevvvtntvphevqklqcpkiktvdislilseairrihngesma
ylfr

Sequence, based on observed residues (ATOM records):

>d2c4kd2 c.61.1.2 (D:167-350) PRPP synthetase-associated protein 1 {Human (Homo sapiens) [TaxId: 9606]}
nyrnavivakspdaakraqsyaerlrlglavihppitvvgdvggriaiivddiiddvesf
vaaaeilkergaykiyvmathgilsaeaprlieessvdevvvtntvphevqklqcpkikt
vdislilseairrihngesmaylfr

Timeline for d2c4kd2:

• d2c4kd2 is new in SCOP 1.73
  
• d2c4kd2 appears in SCOP 1.75
  
• d2c4kd2 appears in the current release, SCOPe 2.08