Lineage for d2c4jd1 (2c4j D:86-218)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 769705Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 769706Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 769707Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)
  6. 769870Protein Class mu GST [81348] (3 species)
  7. 769878Species Human (Homo sapiens) [TaxId:9606] [47622] (15 PDB entries)
    Uniprot P09488 P28161
  8. 769882Domain d2c4jd1: 2c4j D:86-218 [129822]
    Other proteins in same PDB: d2c4ja2, d2c4jb2, d2c4jc2, d2c4jd2
    automatically matched to d1hna_1
    complexed with gso; mutant

Details for d2c4jd1

PDB Entry: 2c4j (more details), 1.35 Å

PDB Description: human glutathione-s-transferase m2-2 t210s mutant in complex with glutathione-styrene oxide conjugate
PDB Compounds: (D:) Glutathione S-transferase Mu 2

SCOP Domain Sequences for d2c4jd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c4jd1 a.45.1.1 (D:86-218) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}
lcgesekeqiredilenqfmdsrmqlaklcydpdfeklkpeylqalpemlklysqflgkq
pwflgdkitfvdfiaydvlernqvfepscldafpnlkdfisrfeglekisaymkssrflp
rpvfskmavwgnk

SCOP Domain Coordinates for d2c4jd1:

Click to download the PDB-style file with coordinates for d2c4jd1.
(The format of our PDB-style files is described here.)

Timeline for d2c4jd1: