SCOPe 2.01: Domain d2c4jc1: 2c4j C:86-218

Lineage for d2c4jc1 (2c4j C:86-218)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)

6. Protein Class mu GST [81348] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47622] (15 PDB entries)
   Uniprot P09488 P28161

8. Domain d2c4jc1: 2c4j C:86-218 [129820]
   Other proteins in same PDB: d2c4ja2, d2c4jb2, d2c4jc2, d2c4jd2
   automatically matched to d1hna_1
   complexed with gso; mutant

Details for d2c4jc1

PDB Entry: 2c4j, 1.35 Å

PDB Description: human glutathione-s-transferase m2-2 t210s mutant in complex with glutathione-styrene oxide conjugate

PDB Compounds: (C:) Glutathione S-transferase Mu 2

SCOPe Domain Sequences for d2c4jc1:

Sequence; same for both SEQRES and ATOM records:

>d2c4jc1 a.45.1.1 (C:86-218) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}
lcgesekeqiredilenqfmdsrmqlaklcydpdfeklkpeylqalpemlklysqflgkq
pwflgdkitfvdfiaydvlernqvfepscldafpnlkdfisrfeglekisaymkssrflp
rpvfskmavwgnk

Timeline for d2c4jc1:

• d2c4jc1 first appeared in SCOP 1.73
  
• d2c4jc1 appears in SCOP 1.75
  
• d2c4jc1 appears in SCOPe 2.02
  
• d2c4jc1 appears in the current release, SCOPe 2.08