Lineage for d2c4gd2 (2c4g D:310-432)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1495403Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 1495404Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 1495405Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 1495418Protein Cyclin A [47956] (2 species)
  7. 1495454Species Human (Homo sapiens) [TaxId:9606] [47957] (74 PDB entries)
    Uniprot P20248 175-432
  8. 1495680Domain d2c4gd2: 2c4g D:310-432 [129814]
    Other proteins in same PDB: d2c4ga_, d2c4gc_
    automated match to d1vywb2
    complexed with 514, so4

Details for d2c4gd2

PDB Entry: 2c4g (more details), 2.7 Å

PDB Description: structure of cdk2-cyclin a with pha-533514
PDB Compounds: (D:) cyclin a2

SCOPe Domain Sequences for d2c4gd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c4gd2 a.74.1.1 (D:310-432) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
tvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvtg
qswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppet
lnl

SCOPe Domain Coordinates for d2c4gd2:

Click to download the PDB-style file with coordinates for d2c4gd2.
(The format of our PDB-style files is described here.)

Timeline for d2c4gd2: