SCOPe 2.02: Domain d2c4gd1: 2c4g D:181-308

Lineage for d2c4gd1 (2c4g D:181-308)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (3 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (8 proteins)

6. Protein Cyclin A [47956] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47957] (52 PDB entries)
   Uniprot P20248 175-432

8. Domain d2c4gd1: 2c4g D:181-308 [129813]
   Other proteins in same PDB: d2c4ga_, d2c4gc_
   automatically matched to d1vin_1
   complexed with 514, so4

Details for d2c4gd1

PDB Entry: 2c4g, 2.7 Å

PDB Description: structure of cdk2-cyclin a with pha-533514

PDB Compounds: (D:) cyclin a2

SCOPe Domain Sequences for d2c4gd1:

Sequence; same for both SEQRES and ATOM records:

>d2c4gd1 a.74.1.1 (D:181-308) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
dihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhlavnyid
rflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrmehlvlk
vltfdlaa

Timeline for d2c4gd1:

• d2c4gd1 first appeared in SCOP 1.73
  
• d2c4gd1 appears in SCOPe 2.01
  
• d2c4gd1 appears in SCOPe 2.03
  
• d2c4gd1 appears in the current release, SCOPe 2.08