Lineage for d2c4gb1 (2c4g B:181-308)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1091941Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 1091942Superfamily a.74.1: Cyclin-like [47954] (3 families) (S)
    duplication: consists of two domains of this fold
  5. 1091943Family a.74.1.1: Cyclin [47955] (8 proteins)
  6. 1091956Protein Cyclin A [47956] (2 species)
  7. 1091988Species Human (Homo sapiens) [TaxId:9606] [47957] (52 PDB entries)
    Uniprot P20248 175-432
  8. 1092135Domain d2c4gb1: 2c4g B:181-308 [129810]
    Other proteins in same PDB: d2c4ga_, d2c4gc_
    automatically matched to d1vin_1
    complexed with 514, so4

Details for d2c4gb1

PDB Entry: 2c4g (more details), 2.7 Å

PDB Description: structure of cdk2-cyclin a with pha-533514
PDB Compounds: (B:) cyclin a2

SCOPe Domain Sequences for d2c4gb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c4gb1 a.74.1.1 (B:181-308) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
dihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhlavnyid
rflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrmehlvlk
vltfdlaa

SCOPe Domain Coordinates for d2c4gb1:

Click to download the PDB-style file with coordinates for d2c4gb1.
(The format of our PDB-style files is described here.)

Timeline for d2c4gb1: