Class g: Small proteins [56992] (92 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (8 families) |
Family g.3.11.1: EGF-type module [57197] (23 proteins) |
Protein Coagulation factor VIIa [57201] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57202] (56 PDB entries) Uniprot P08709 108-202 ! Uniprot P08709 107-202 |
Domain d2c4fl2: 2c4f L:91-140 [129807] Other proteins in same PDB: d2c4fh1, d2c4fl3, d2c4fu1 automatically matched to d1pfxl2 complexed with ca, fuc, gil, glc, nag |
PDB Entry: 2c4f (more details), 1.72 Å
SCOPe Domain Sequences for d2c4fl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c4fl2 g.3.11.1 (L:91-140) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} cvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipi
Timeline for d2c4fl2: