Lineage for d2c4fl2 (2c4f L:91-140)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 747016Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 747704Superfamily g.3.11: EGF/Laminin [57196] (7 families) (S)
  5. 747705Family g.3.11.1: EGF-type module [57197] (22 proteins)
  6. 747785Protein Factor IX (IXa) [57198] (2 species)
  7. 747791Species Pig (Sus scrofa) [TaxId:9823] [57200] (16 PDB entries)
  8. 747793Domain d2c4fl2: 2c4f L:91-140 [129807]
    Other proteins in same PDB: d2c4fh1, d2c4fl3
    automatically matched to d1pfxl2
    complexed with ca, fuc, gil, glc, nag

Details for d2c4fl2

PDB Entry: 2c4f (more details), 1.72 Å

PDB Description: crystal structure of factor vii.stf complexed with pd0297121
PDB Compounds: (L:) coagulation factor vii precursor

SCOP Domain Sequences for d2c4fl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c4fl2 g.3.11.1 (L:91-140) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]}
cvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipi

SCOP Domain Coordinates for d2c4fl2:

Click to download the PDB-style file with coordinates for d2c4fl2.
(The format of our PDB-style files is described here.)

Timeline for d2c4fl2:

View in 3D
Domains from other chains:
(mouse over for more information)
d2c4fh1