SCOPe 2.06: Domain d2c4fl1: 2c4f L:46-82

Lineage for d2c4fl1 (2c4f L:46-82)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein Coagulation factor VIIa [57201] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57202] (96 PDB entries)
   Uniprot P08709 108-202 ! Uniprot P08709 107-202

8. Domain d2c4fl1: 2c4f L:46-82 [129806]
   Other proteins in same PDB: d2c4fh1, d2c4fl3, d2c4fu1
   automatically matched to d1pfxl1
   complexed with ca, fuc, gil, glc, nag

Details for d2c4fl1

PDB Entry: 2c4f, 1.72 Å

PDB Description: crystal structure of factor vii.stf complexed with pd0297121

PDB Compounds: (L:) coagulation factor vii precursor

SCOPe Domain Sequences for d2c4fl1:

Sequence; same for both SEQRES and ATOM records:

>d2c4fl1 g.3.11.1 (L:46-82) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
dgdqcasspcqnggsckdqlqsyicfclpafegrnce

Timeline for d2c4fl1:

• d2c4fl1 first appeared in SCOP 1.73
  
• d2c4fl1 appears in SCOPe 2.05
  
• d2c4fl1 appears in SCOPe 2.07
  
• d2c4fl1 appears in the current release, SCOPe 2.08