Lineage for d2c4fl1 (2c4f L:46-82)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1061532Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1062283Superfamily g.3.11: EGF/Laminin [57196] (7 families) (S)
  5. 1062284Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 1062362Protein Factor IX (IXa) [57198] (2 species)
  7. 1062376Species Pig (Sus scrofa) [TaxId:9823] [57200] (16 PDB entries)
  8. 1062377Domain d2c4fl1: 2c4f L:46-82 [129806]
    Other proteins in same PDB: d2c4fh1, d2c4fl3, d2c4fu1
    automatically matched to d1pfxl1
    complexed with ca, fuc, gil, glc, nag

Details for d2c4fl1

PDB Entry: 2c4f (more details), 1.72 Å

PDB Description: crystal structure of factor vii.stf complexed with pd0297121
PDB Compounds: (L:) coagulation factor vii precursor

SCOPe Domain Sequences for d2c4fl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]}
dgdqcasspcqnggsckdqlqsyicfclpafegrnce

SCOPe Domain Coordinates for d2c4fl1:

Click to download the PDB-style file with coordinates for d2c4fl1.
(The format of our PDB-style files is described here.)

Timeline for d2c4fl1: