Lineage for d2c4ba1 (2c4b A:3-110)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2530963Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. 2530964Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) (S)
  5. 2530965Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins)
  6. 2530966Protein Barnase [81305] (1 species)
  7. 2530967Species Bacillus amyloliquefaciens [TaxId:1390] [53945] (49 PDB entries)
  8. 2530971Domain d2c4ba1: 2c4b A:3-110 [129801]
    Other proteins in same PDB: d2c4ba2, d2c4bb2
    automatically matched to d1b3sa_
    complexed with 2pe, edo, fmt, gol, mes, so4, unx; mutant

Details for d2c4ba1

PDB Entry: 2c4b (more details), 1.3 Å

PDB Description: inhibitor cystine knot protein mcoeeti fused to the catalytically inactive barnase mutant h102a
PDB Compounds: (A:) barnase mcoeeti fusion

SCOPe Domain Sequences for d2c4ba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c4ba1 d.1.1.2 (A:3-110) Barnase {Bacillus amyloliquefaciens [TaxId: 1390]}
vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk
lpgksgrtwreadinytsgfrnsdrilyssdwliykttdayqtftkir

SCOPe Domain Coordinates for d2c4ba1:

Click to download the PDB-style file with coordinates for d2c4ba1.
(The format of our PDB-style files is described here.)

Timeline for d2c4ba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2c4ba2