SCOPe 2.05: Domain d2c4ba1: 2c4b A:3-110

Lineage for d2c4ba1 (2c4b A:3-110)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
   single helix packs against antiparallel beta-sheet

4. Superfamily d.1.1: Microbial ribonucleases [53933] (4 families)

5. Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins)

6. Protein Barnase [81305] (1 species)

7. Species Bacillus amyloliquefaciens [TaxId:1390] [53945] (49 PDB entries)

8. Domain d2c4ba1: 2c4b A:3-110 [129801]
   Other proteins in same PDB: d2c4ba2, d2c4bb2
   automatically matched to d1b3sa_
   complexed with 2pe, edo, fmt, gol, mes, so4, unx; mutant

Details for d2c4ba1

PDB Entry: 2c4b, 1.3 Å

PDB Description: inhibitor cystine knot protein mcoeeti fused to the catalytically inactive barnase mutant h102a

PDB Compounds: (A:) barnase mcoeeti fusion

SCOPe Domain Sequences for d2c4ba1:

Sequence; same for both SEQRES and ATOM records:

>d2c4ba1 d.1.1.2 (A:3-110) Barnase {Bacillus amyloliquefaciens [TaxId: 1390]}
vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk
lpgksgrtwreadinytsgfrnsdrilyssdwliykttdayqtftkir

Timeline for d2c4ba1:

• d2c4ba1 first appeared in SCOP 1.73
  
• d2c4ba1 appears in SCOPe 2.04
  
• d2c4ba1 appears in SCOPe 2.06
  
• d2c4ba1 appears in the current release, SCOPe 2.08