Lineage for d2c4ba1 (2c4b A:3-110)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 849710Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. 849711Superfamily d.1.1: Microbial ribonucleases [53933] (3 families) (S)
  5. 849712Family d.1.1.2: Bacterial ribonucleases [81307] (5 proteins)
  6. 849713Protein Barnase [81305] (1 species)
  7. 849714Species Bacillus amyloliquefaciens [TaxId:1390] [53945] (43 PDB entries)
  8. 849715Domain d2c4ba1: 2c4b A:3-110 [129801]
    Other proteins in same PDB: d2c4ba2, d2c4bb2
    automatically matched to d1b3sa_
    complexed with 2pe, edo, fmt, gol, mes, so4, unx; mutant

Details for d2c4ba1

PDB Entry: 2c4b (more details), 1.3 Å

PDB Description: inhibitor cystine knot protein mcoeeti fused to the catalytically inactive barnase mutant h102a
PDB Compounds: (A:) barnase mcoeeti fusion

SCOP Domain Sequences for d2c4ba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c4ba1 d.1.1.2 (A:3-110) Barnase {Bacillus amyloliquefaciens [TaxId: 1390]}
vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk
lpgksgrtwreadinytsgfrnsdrilyssdwliykttdayqtftkir

SCOP Domain Coordinates for d2c4ba1:

Click to download the PDB-style file with coordinates for d2c4ba1.
(The format of our PDB-style files is described here.)

Timeline for d2c4ba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2c4ba2