Lineage for d2c42b5 (2c42 B:669-785)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1906288Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 1906422Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins)
    members of this "family" may be more closely related to other ferredoxins than to each other
  6. 1906527Protein Pyruvate-ferredoxin oxidoreductase, PFOR, domain V [54889] (1 species)
  7. 1906528Species Desulfovibrio africanus [TaxId:873] [54890] (10 PDB entries)
  8. 1906530Domain d2c42b5: 2c42 B:669-785 [129799]
    Other proteins in same PDB: d2c42a1, d2c42a2, d2c42a3, d2c42a4, d2c42b1, d2c42b2, d2c42b3, d2c42b4
    automated match to d1keka5
    complexed with ca, mg, pyr, sf4, tpp

Details for d2c42b5

PDB Entry: 2c42 (more details), 1.78 Å

PDB Description: Crystal Structure Of Pyruvate-Ferredoxin Oxidoreductase From Desulfovibrio africanus
PDB Compounds: (B:) pyruvate-ferredoxin oxidoreductase

SCOPe Domain Sequences for d2c42b5:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c42b5 d.58.1.5 (B:669-785) Pyruvate-ferredoxin oxidoreductase, PFOR, domain V {Desulfovibrio africanus [TaxId: 873]}
tsqfekrgvainvpqwvpenciqcnqcafvcphsailpvlakeeelvgapanftaleakg
kelkgykfriqintldcmgcgncadicppkekalvmqpldtqrdaqvpnleyaarip

SCOPe Domain Coordinates for d2c42b5:

Click to download the PDB-style file with coordinates for d2c42b5.
(The format of our PDB-style files is described here.)

Timeline for d2c42b5: