Lineage for d2c42a2 (2c42 A:786-1232)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1361462Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 1361463Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 1362028Family c.36.1.12: PFOR PP module [88771] (1 protein)
    domains VI, I and II are arranged in the same way as the TK PP, Pyr and C domains
  6. 1362029Protein Pyruvate-ferredoxin oxidoreductase, PFOR, domains VI [88772] (1 species)
  7. 1362030Species Desulfovibrio africanus [TaxId:873] [88773] (10 PDB entries)
  8. 1362031Domain d2c42a2: 2c42 A:786-1232 [129791]
    Other proteins in same PDB: d2c42a1, d2c42a3, d2c42a4, d2c42a5, d2c42b1, d2c42b3, d2c42b4, d2c42b5
    automated match to d1keka2
    complexed with ca, mg, pyr, sf4, tpp

Details for d2c42a2

PDB Entry: 2c42 (more details), 1.78 Å

PDB Description: Crystal Structure Of Pyruvate-Ferredoxin Oxidoreductase From Desulfovibrio africanus
PDB Compounds: (A:) pyruvate-ferredoxin oxidoreductase

SCOPe Domain Sequences for d2c42a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c42a2 c.36.1.12 (A:786-1232) Pyruvate-ferredoxin oxidoreductase, PFOR, domains VI {Desulfovibrio africanus [TaxId: 873]}
vksevlprdslkgsqfqeplmefsgacsgcgetpyvrvitqlfgermfianatgcssiwg
asapsmpyktnrlgqgpawgnslfedaaeygfgmnmsmfarrthladlaakalesdasgd
vkealqgwlagkndpikskeygdklkkllagqkdgllgqiaamsdlytkksvwifggdgw
aydigyggldhvlasgedvnvfvmdtevysntggqsskatptgavakfaaagkrtgkkdl
armvmtygyvyvatvsmgyskqqflkvlkeaesfpgpslviayatcinqglrkgmgksqd
vmntavksgywplfrydprlaaqgknpfqldskapdgsveeflmaqnrfavldrsfpeda
krlraqvaheldvrfkelehmaatnifesfapaggkadgsvdfgegaefctrddtpmmar
pdsgeacdqnragtseqqgdlskrtkk

SCOPe Domain Coordinates for d2c42a2:

Click to download the PDB-style file with coordinates for d2c42a2.
(The format of our PDB-style files is described here.)

Timeline for d2c42a2: