Lineage for d2c3ya3 (2c3y A:259-415)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2880614Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. 2880615Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) (S)
  5. 2880764Family c.48.1.3: Pyruvate-ferredoxin oxidoreductase, PFOR, domain II [52931] (1 protein)
  6. 2880765Protein Pyruvate-ferredoxin oxidoreductase, PFOR, domain II [52932] (1 species)
  7. 2880766Species Desulfovibrio africanus [TaxId:873] [52933] (10 PDB entries)
  8. 2880773Domain d2c3ya3: 2c3y A:259-415 [129782]
    Other proteins in same PDB: d2c3ya1, d2c3ya2, d2c3ya4, d2c3ya5, d2c3yb1, d2c3yb2, d2c3yb4, d2c3yb5
    automated match to d1keka3
    complexed with ca, co2, htl, mg, sf4

Details for d2c3ya3

PDB Entry: 2c3y (more details), 1.93 Å

PDB Description: crystal structure of the radical form of pyruvate:ferredoxin oxidoreductase from desulfovibrio africanus
PDB Compounds: (A:) pyruvate-ferredoxin oxidoreductase

SCOPe Domain Sequences for d2c3ya3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c3ya3 c.48.1.3 (A:259-415) Pyruvate-ferredoxin oxidoreductase, PFOR, domain II {Desulfovibrio africanus [TaxId: 873]}
klfdyvgapdaervivsmgsscetieevinhlaakgekiglikvrlyrpfvseaffaalp
asakvitvldrtkepgapgdplyldvcsafvergeampkilagryglgskefspamvksv
ydnmsgakknhftvgieddvtgtslpvdnafadttpk

SCOPe Domain Coordinates for d2c3ya3:

Click to download the PDB-style file with coordinates for d2c3ya3.
(The format of our PDB-style files is described here.)

Timeline for d2c3ya3: