Lineage for d2c3pb5 (2c3p B:669-785)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1650133Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1650134Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 1650266Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins)
    members of this "family" may be more closely related to other ferredoxins than to each other
  6. 1650371Protein Pyruvate-ferredoxin oxidoreductase, PFOR, domain V [54889] (1 species)
  7. 1650372Species Desulfovibrio africanus [TaxId:873] [54890] (10 PDB entries)
  8. 1650382Domain d2c3pb5: 2c3p B:669-785 [129769]
    Other proteins in same PDB: d2c3pa1, d2c3pa2, d2c3pa3, d2c3pa4, d2c3pb1, d2c3pb2, d2c3pb3, d2c3pb4
    automated match to d1keka5
    complexed with 1tp, ca, mg, sf4

Details for d2c3pb5

PDB Entry: 2c3p (more details), 2.33 Å

PDB Description: crystal structure of the free radical intermediate of pyruvate:ferredoxin oxidoreductase from desulfovibrio africanus
PDB Compounds: (B:) pyruvate-ferredoxin oxidoreductase

SCOPe Domain Sequences for d2c3pb5:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c3pb5 d.58.1.5 (B:669-785) Pyruvate-ferredoxin oxidoreductase, PFOR, domain V {Desulfovibrio africanus [TaxId: 873]}
tsqfekrgvainvpqwvpenciqcnqcafvcphsailpvlakeeelvgapanftaleakg
kelkgykfriqintldcmgcgncadicppkekalvmqpldtqrdaqvpnleyaarip

SCOPe Domain Coordinates for d2c3pb5:

Click to download the PDB-style file with coordinates for d2c3pb5.
(The format of our PDB-style files is described here.)

Timeline for d2c3pb5: