Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) |
Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins) members of this "family" may be more closely related to other ferredoxins than to each other |
Protein Pyruvate-ferredoxin oxidoreductase, PFOR, domain V [54889] (1 species) |
Species Desulfovibrio africanus [TaxId:873] [54890] (10 PDB entries) |
Domain d2c3pb5: 2c3p B:669-785 [129769] Other proteins in same PDB: d2c3pa1, d2c3pa2, d2c3pa3, d2c3pa4, d2c3pb1, d2c3pb2, d2c3pb3, d2c3pb4 automated match to d1keka5 complexed with 1tp, ca, mg, sf4 |
PDB Entry: 2c3p (more details), 2.33 Å
SCOPe Domain Sequences for d2c3pb5:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c3pb5 d.58.1.5 (B:669-785) Pyruvate-ferredoxin oxidoreductase, PFOR, domain V {Desulfovibrio africanus [TaxId: 873]} tsqfekrgvainvpqwvpenciqcnqcafvcphsailpvlakeeelvgapanftaleakg kelkgykfriqintldcmgcgncadicppkekalvmqpldtqrdaqvpnleyaarip
Timeline for d2c3pb5: