Lineage for d2c3pb3 (2c3p B:259-415)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 700279Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. 700280Superfamily c.48.1: TK C-terminal domain-like [52922] (3 families) (S)
  5. 700380Family c.48.1.3: Pyruvate-ferredoxin oxidoreductase, PFOR, domain II [52931] (1 protein)
  6. 700381Protein Pyruvate-ferredoxin oxidoreductase, PFOR, domain II [52932] (1 species)
  7. 700382Species Desulfovibrio africanus [TaxId:873] [52933] (9 PDB entries)
  8. 700390Domain d2c3pb3: 2c3p B:259-415 [129767]
    Other proteins in same PDB: d2c3pa1, d2c3pa2, d2c3pa4, d2c3pa5, d2c3pb1, d2c3pb2, d2c3pb4, d2c3pb5
    automatically matched to d1b0pa3
    complexed with 1tp, ca, mg, sf4

Details for d2c3pb3

PDB Entry: 2c3p (more details), 2.33 Å

PDB Description: crystal structure of the free radical intermediate of pyruvate:ferredoxin oxidoreductase from desulfovibrio africanus
PDB Compounds: (B:) pyruvate-ferredoxin oxidoreductase

SCOP Domain Sequences for d2c3pb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c3pb3 c.48.1.3 (B:259-415) Pyruvate-ferredoxin oxidoreductase, PFOR, domain II {Desulfovibrio africanus [TaxId: 873]}
klfdyvgapdaervivsmgsscetieevinhlaakgekiglikvrlyrpfvseaffaalp
asakvitvldrtkepgapgdplyldvcsafvergeampkilagryglgskefspamvksv
ydnmsgakknhftvgieddvtgtslpvdnafadttpk

SCOP Domain Coordinates for d2c3pb3:

Click to download the PDB-style file with coordinates for d2c3pb3.
(The format of our PDB-style files is described here.)

Timeline for d2c3pb3: