Lineage for d2c3ob5 (2c3o B:669-785)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 723374Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (6 families) (S)
  5. 723475Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (11 proteins)
    members of this "family" may be more closely related to other ferredoxins than to each other
  6. 723537Protein Pyruvate-ferredoxin oxidoreductase, PFOR, domain V [54889] (1 species)
  7. 723538Species Desulfovibrio africanus [TaxId:873] [54890] (9 PDB entries)
  8. 723554Domain d2c3ob5: 2c3o B:669-785 [129759]
    Other proteins in same PDB: d2c3oa1, d2c3oa2, d2c3oa3, d2c3oa4, d2c3ob1, d2c3ob2, d2c3ob3, d2c3ob4
    automatically matched to d1b0pa5
    complexed with ca, mg, pyr, sf4, tpp

Details for d2c3ob5

PDB Entry: 2c3o (more details), 2.7 Å

PDB Description: crystal structure of the free radical intermediate of pyruvate:ferredoxin oxidoreductase from desulfovibrio africanus
PDB Compounds: (B:) pyruvate-ferredoxin oxidoreductase

SCOP Domain Sequences for d2c3ob5:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c3ob5 d.58.1.5 (B:669-785) Pyruvate-ferredoxin oxidoreductase, PFOR, domain V {Desulfovibrio africanus [TaxId: 873]}
tsqfekrgvainvpqwvpenciqcnqcafvcphsailpvlakeeelvgapanftaleakg
kelkgykfriqintldcmgcgncadicppkekalvmqpldtqrdaqvpnleyaarip

SCOP Domain Coordinates for d2c3ob5:

Click to download the PDB-style file with coordinates for d2c3ob5.
(The format of our PDB-style files is described here.)

Timeline for d2c3ob5: