![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.48: TK C-terminal domain-like [52921] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest |
![]() | Superfamily c.48.1: TK C-terminal domain-like [52922] (3 families) ![]() |
![]() | Family c.48.1.3: Pyruvate-ferredoxin oxidoreductase, PFOR, domain II [52931] (1 protein) |
![]() | Protein Pyruvate-ferredoxin oxidoreductase, PFOR, domain II [52932] (1 species) |
![]() | Species Desulfovibrio africanus [TaxId:873] [52933] (9 PDB entries) |
![]() | Domain d2c3ob3: 2c3o B:259-415 [129757] Other proteins in same PDB: d2c3oa1, d2c3oa2, d2c3oa4, d2c3oa5, d2c3ob1, d2c3ob2, d2c3ob4, d2c3ob5 automatically matched to d1b0pa3 complexed with ca, mg, pyr, sf4, tpp |
PDB Entry: 2c3o (more details), 2.7 Å
SCOP Domain Sequences for d2c3ob3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c3ob3 c.48.1.3 (B:259-415) Pyruvate-ferredoxin oxidoreductase, PFOR, domain II {Desulfovibrio africanus [TaxId: 873]} klfdyvgapdaervivsmgsscetieevinhlaakgekiglikvrlyrpfvseaffaalp asakvitvldrtkepgapgdplyldvcsafvergeampkilagryglgskefspamvksv ydnmsgakknhftvgieddvtgtslpvdnafadttpk
Timeline for d2c3ob3: